General Information

  • ID:  hor002882
  • Uniprot ID:  P17681
  • Protein name:  Histidine-rich basic peptide
  • Gene name:  NA
  • Organism:  Aplysia fasciata (Mottled sea hare) (Aplysia brasiliana)
  • Family:  NA
  • Source:  animal
  • Expression:  Neurons R3-R14. A cluster of 12 giant neurons located on the right side of the abdominal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA
  • Length:  43(43-85)
  • Propeptide:  EEVFDDTDVGDELTNALESVLTDLKDKRDAEEPSAFMTRLRRQVAQMHIWRAVNHDRHHSTGSGRHSRFLTRNRYRYGGGHLSDA
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Excites Aplysia heart and enhances gut motility
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P17681-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002882_AF2.pdbhor002882_ESM.pdb

Physical Information

Mass: 577584 Formula: C214H327N81O60S
Absent amino acids: CEKP Common amino acids: R
pI: 12.11 Basic residues: 13
Polar residues: 15 Hydrophobic residues: 10
Hydrophobicity: -119.07 Boman Index: -15259
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 47.67
Instability Index: 4045.81 Extinction Coefficient cystines: 8480
Absorbance 280nm: 201.9

Literature

  • PubMed ID:  2587425
  • Title:  Aplysia brasiliana neurons R3-R14: primary structure of the myoactive histidine-rich basic peptide and its prohormone.